missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AKT1 (aa 85-188) Control Fragment Recombinant Protein

Product Code. 30198078
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198078

Brand: Invitrogen™ RP89053

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AKT1 (PKB alpha) is a serine/threonine kinase that regulates cell survival. The activated enzyme inhibits apoptosis and stimulates cell cycle progression by phosphorylating numerous targets in various cell types, including cancer cells. This protein kinase is activated by insulin, PI3K, IGF1 and various other growth and survival factors. Akt promotes cell survival by inhibiting apoptosis through phosphorylation and inactivation of several targets, including forkhead transcription factors, and caspase-9. The AKT pathway is a major target for cancer drug discovery.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31749
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 207
Name Human AKT1 (aa 85-188) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Akt; Akt kinase; AKT serine/threonine kinase 1; Akt/PKB; akt1; AKT1 kinase; AKT1m; Akt1m protein; Akt1-PA; Akt1-PB; Akt1-PC; Akt1-PD; Akt1-PE; CAKT; C-AKT; CG4006; CG4006-PA; CG4006-PB; CG4006-PC; CG4006-PD; CG4006-PE; CWS6; dAkt; D-Akt; dAkt kinase; dAKT/dPKB; dAkt/PKB; DAKT1; DAKT1/PKB; Dmel\CG4006; Dmel_CG4006; dPKB; DRAC-Pk.; DRAC-PK66; DRAC-PK85; l(3)04226; l(3)89 Bq; murine thymoma viral (v-akt) oncogene homolog 1; pAkt; P-AKT; PKB; PKB alpha; PKB beta; PKB gamma; PKB/AKT; PKB/dAKT; PKBalpha; PKB-ALPHA; PKBG; PRKBA; protein kinase B; Protein kinase B alpha; protein kinase B-alpha; proto-oncogene c-Akt; RAC; rac protein kinase alpha; RAC protein kinase alpha RAC-Pk. alpha; RAC serine/threonine protein kinase; RAC serine/threonine-protein kinase; RAC-ALPHA; RAC-alpha serine/threonine-protein kinase; RacPK; RAC-Pk.-alpha; RAC-Pk.-beta; RAC-Pk.-gamma; related to A and C kinases; related to Pk. to PKC protein kinases; related to the A and C kinases; SD10374p; serine/threonine protein kinase; serine-threonine protein kinase; Thymoma viral proto-oncogene; thymoma viral proto-oncogene 1; v-akt murine thymoma viral oncogene homolog 1; v-akt murine thymoma viral oncogene-like protein 1
Common Name AKT1
Gene Symbol AKT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.