missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197243

Invitrogen™ Human AKR1B10 (aa 81-137) Control Fragment Recombinant Protein

Product Code. 30197243
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197243

Brand: Invitrogen™ RP92849

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82718 (PA5-82718. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AKR1B10, a 316aa protein, catalyzes efficient reduction ofaliphatic and aromatic aldehydes. It the first cytosolic NADP (H)-dependent retinal reductase described in humans and is characterized by the presence of a novel NADP binding motif. Due to its ability to convert glucose to sorbitol, AKR1B10 may have a role in development of secondary diabetic complications.It is abundantly expressed in adrenal gland, small intestine and colon, with lower levels in liver, thymus, prostate, testis, and skeletal muscle and its levels are up regulated in certain cancers such as hepatocellular carcinoma.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O60218
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57016
Name Human AKR1B10 (aa 81-137) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310005E10Rik; AKR1B10; AKR1B11; AKR1B12; Akr1b16; aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); Aldose reductase-like; aldose reductase-like 1; aldose reductase-like peptide; aldose reductase-related protein; ALDRLn; ARL1; ARL-1; ARP; hARP; HIS; HSI; MGC14103; SI reductase; small intestine reductase
Common Name AKR1B10
Gene Symbol Akr1b10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKAT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.