missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197190

Invitrogen™ Human AKR1A1 (aa 123-199) Control Fragment Recombinant Protein

Product Code. 30197190
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197190

Brand: Invitrogen™ RP92379

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82685 (PA5-82685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member, also known as aldehyde reductase, is involved in the reduction of biogenic and xenobiotic aldehydes and is present in virtually every tissue. Multiple alternatively spliced transcript variants of this gene exist, all encoding the same protein.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P14550
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10327
Name Human AKR1A1 (aa 123-199) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610201A18Rik; 3-DG-reducing enzyme; Akr1a1; AKR1A1 protein; Akr1a4; alcohol dehydrogenase; alcohol dehydrogenase [NADP(+)]; Aldehyde reductase; aldo-keto reductase family 1 member A1; aldo-keto reductase family 1, member A1 (aldehyde reductase); aldo-keto reductase family 1, member A4 (aldehyde reductase); ALDR1; ALR; ARM; DD3; dihydrodiol dehydrogenase 3; epididymis secretory protein Li 6; epididymis secretory sperm binding protein Li 165 mP; Glucuronate reductase; Glucuronolactone reductase; HEL-S-165 mP; HEL-S-6; MGC12529; MGC1380; OTTHUMP00000009240
Common Name AKR1A1
Gene Symbol AKR1A1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRPAVLQVECHPYLAQNELIAH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.