Invitrogen™ Human Akirin1 (aa 68-133) Control Fragment Recombinant Protein

Product Code. 30194784

Brand: Invitrogen™ RP101506

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62506 (PA5-62506. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The highly conserved, nuclear-localized Akirin1 and Akirin2 proteins critically regulate the transcription of NF-kappa-B-dependent genes and are required for defense against Gram-negative bacteria in the immune deficiency and NF-kappa-B pathways. Akirin1 is dispensable in the mouse, and neither knockout mice nor cells derived from them have obvious distinctive phenotypes. In contrast, Akirin2 is required for development in the mouse and knockout of both Akirin homologs in mice show that Akirin2 is required downstream of toll-like receptor (TLR), TNF-a and IL-1-b signaling, and for the production of IL-6. Akirin2 is functionally closer to the single gene in Drosophila, as the homozygous null D. melanogaster Akirin mutants show a similar, mid-to-early embryonic death.

Specifications

• Accession Number: Q9H9L7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79647
• Name: Human Akirin1 (aa 68-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330407G11Rik; akirin 1; AKIRIN1; akirin-1; C1orf108; Mighty; Mighty protein; MNCb-2831; RP11-781D11.2; STRF2
• Common Name: AKIRIN1
• Gene Symbol: AKIRIN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRLPTPEQIFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining