missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AKAP7 (aa 26-96) Control Fragment Recombinant Protein

Product Code. 30193920
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193920

Brand: Invitrogen™ RP94716

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55822 (PA5-55822. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the A-kinase anchoring protein family, a group of functionally related proteins that bind to a regulatory subunit of cAMP-dependent protein kinase A and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43687, Q9P0M2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9465
Name Human AKAP7 (aa 26-96) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6430401D08; A kinase (PRKA) anchor protein 7; AI662165; AKAP 18; AKAP 9; AKAP15; AKAP18; AKAP-18; AKAP-18 {ECO:0000250; AKAP18d; Akap7; akap7 {ECO:0000312; AKAP-7 isoform alpha; AKAP-7 isoform gamma; AKAP-7 isoforms alpha and beta; AKAP-7 isoforms delta and gamma; A-kinase anchor protein 18; A-kinase anchor protein 18 {ECO:0000250; A-kinase anchor protein 18 kDa; A-kinase anchor protein 7; A-kinase anchor protein 7 isoform alpha; A-kinase anchor protein 7 isoform gamma; A-kinase anchor protein 7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms delta and gamma; A-kinase anchor protein 9 kDa; A-kinase anchoring protein 18 ,isoform delta; A-kinase anchoring protein 7; BB170514; PRKA7 isoform alpha; PRKA7 isoform gamma; PRKA7 isoforms alpha/beta; PRKA7 isoforms delta and gamma; protein kinase A anchoring protein 7; protein kinase A-anchoring protein 7 isoform alpha; Protein kinase A-anchoring protein 7 isoform gamma; Protein kinase A-anchoring protein 7 isoforms alpha/beta; Protein kinase A-anchoring protein 7 isoforms delta and gamma; RGD:1303071}; UniProtKB:F8VQ58}
Common Name AKAP7
Gene Symbol AKAP7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EFEANTMDSLVDMPFATVDIQDDCGITDEPQINLKRSQENEWVKSDQVKKRKKKRKDYQPNYFLSIPITNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.