missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210898

Invitrogen™ Human AKAP3 (aa 363-452) Control Fragment Recombinant Protein

Product Code. 30210898
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210898

Brand: Invitrogen™ RP109802

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The type II cAMP-dependent protein kinase (PKA) is a multifunctional kinase with a broad range of substrates. Specificity of PKA signaling is mediated by the compartmentalization of the kinase to specific sites within the cell. To maintain this specific localization, the R subunit (RII) of PKA interacts with specific RII-anchoring proteins, designated A-kinase anchoring proteins (AKAP). AKAP 3, also known as AKAP 110, FSP95, PRKA3 and SOB1, binds both PKA and PDE4A and functions as a scaffolding protein in spermatozoa to regulate local cAMP concentrations and modulate sperm functions. Expression of AKAP 3 in normal tissues is restricted to the testis, where bicarbonate stimulates tyrosine phosphorylation of AKAP 3, thereby increasing its recruitment of PKA. AKAP-3 also exhibits high expression in patients with epithelial ovarian cancer (EOC). It demonstrates tumor-restricted expression and appears to be associated with worse overall survival, which make AKAP 3 a potential target for antigen-specific immunotherapy in EOC.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75969
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10566
Name Human AKAP3 (aa 363-452) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A kinase (PRKA) anchor protein 3; AKAP 110; AKAP110; Akap3; AKAP-3; A-kinase anchor protein 110 kDa; A-kinase anchor protein 3; A-kinase anchor protein, 110 kDa; A-kinase anchoring protein 3; Cancer/testis antigen 82; CT82; epididymis luminal protein 159; Fibrous Sheath Protein of 95 kDa; fibrousheathin 1; Fibrousheathin I; fibrousheathin-1; FSP95; HEL159; PRKA3; protein kinase A binding protein AKAP 110; Protein kinase A-anchoring protein 3; SOB1; Sperm oocyte-binding protein; sperm oocyte-binding protein 1
Common Name AKAP3
Gene Symbol AKAP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vis mere Vis mindre
Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.