Invitrogen™ Human AKAP17A (aa 81-178) Control Fragment Recombinant Protein

Product Code. 30199715

Brand: Invitrogen™ RP100086

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60291 (PA5-60291. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

DXYS155E is a gene found in the pseudoautosomal region of the distal short arms of the X and Y chromosomes, and appears to be ubiquitously expressed.

Specifications

• Accession Number: Q02040
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8227
• Name: Human AKAP17A (aa 81-178) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 721 P; A kinase (PRKA) anchor protein 17 A; AKAP17A; AKAP-17 A; A-kinase anchor protein 17 A; A-kinase anchoring protein 17 A; B-lymphocyte antigen; B-lymphocyte surface antigen; CCDC133; CXYorf3; DXYS155E; PRKA17A; Protein kinase A-anchoring protein 17 A; Protein XE7; pseudoautosomal gene XE7; RP13-297E16.1; SFRS17A; Splicing factor, arginine/serine-rich 17 A; XE7; XE7Y
• Common Name: AKAP17A
• Gene Symbol: AKAP17A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GEVENKSLVKSFLACLDGKTIKLSGFSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNETLPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLVKVF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining