missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209505

Invitrogen™ Human AKAP14 (aa 2-52) Control Fragment Recombinant Protein

Product Code. 30209505
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209505

Brand: Invitrogen™ RP101570

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (29%), Rat (29%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63918 (PA5-63918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. The protein anchors PKA in ciliary axonemes and, in this way, may play a role in regulating ciliary beat frequency. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86UN6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 158798
Name Human AKAP14 (aa 2-52) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A kinase (PRKA) anchor protein 14; AKAP 28; AKAP14; AKAP-14; AKAP28; A-kinase anchor protein 14; A-kinase anchor protein 28 kDa; A-kinase anchoring protein 14; A-kinase anchoring protein 28; PRKA14; Protein kinase A-anchoring protein 14; TAKAP-1.2; Takap80; Testis-specific A-kinase-anchoring protein TAKAP-80; Testis-specific A-kinase-anchoring-protein
Common Name AKAP14
Gene Symbol AKAP14
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SETQNSTSQKAMDEDNKAASQTMPNTQDKNYEDELTQVALALVEDVINYAV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.