Invitrogen™ Human AJM1 (aa 898-974) Control Fragment Recombinant Protein

Product Code. 30202999

Brand: Invitrogen™ RP109785

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145137 (PA5-145137. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AJM1 is a transmembrane protein that plays a crucial role in cell-cell adhesion and maintenance of epithelial cell polarity. It is found in the junctional complex of epithelial cells and is involved in the formation and stabilization of tight junctions.

Specifications

• Accession Number: C9J069
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 389813
• Name: Human AJM1 (aa 898-974) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AJM1; Apical junction component 1 homolog; C9orf172; chromosome 9 open reading frame 172; uncharacterized protein C9orf172
• Common Name: AJM1
• Gene Symbol: AJM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFIHIQRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRALDWVASANLLDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining