Invitrogen™ Human AIM2 (aa 232-309) Control Fragment Recombinant Protein

Product Code. 30211782

Brand: Invitrogen™ RP94437

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2.

Specifications

• Accession Number: O14862
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9447
• Name: Human AIM2 (aa 232-309) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Absent in melanoma 2; AIM2; Gm1313; Ifi210; ifi-210; Interferon-inducible protein 210; interferon-inducible protein AIM2; Interferon-inducible protein p210; PYHIN4; RP11-520H16.3
• Common Name: AIM2
• Gene Symbol: AIM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDQKVNVPLNIIRKAGETPKINTLQTQPLGTIVNGLFVVQKVTEKKKNILFDLSDNTGKMEVLGVRNEDTMKCKEGDK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining