missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203893

Invitrogen™ Human AIM (aa 65-114) Control Fragment Recombinant Protein

Product Code. 30203893
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203893

Brand: Invitrogen™ RP103668

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84779 (PA5-84779. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD5L, also known as CD5 antigen-like, is a protein that is expressed on the surface of various immune cells, including T cells, B cells, and natural killer cells. It is involved in the regulation of immune responses and is being studied as a potential therapeutic target in various diseases, including autoimmune disorders, cancer, and infectious diseases. CD5L is known to modulate T cell activation and cytokine production, and has been shown to have anti-inflammatory effects.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43866
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 922
Name Human AIM (aa 65-114) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1/6; AAC-11; AI047839; AIM; AIM/Spalpha; API6; apoptosis inhibitor 6; apoptosis inhibitor expressed by macrophages; apoptosis inhibitor of macrophage; APOPTOSIS INHIBITOR OF MACROPHAGES; Apoptosis inhibitory 6; CD5 antigen like (scavenger receptor cysteine rich family); CD5 antigen-like; CD5 antigen-like (scavenger receptor cysteine rich family); CD5 molecule like; Cd5 molecule-like; CD5L; CT2; CT-2; hAIM; Highly similar to ANTIGEN WC1.1 [Bos taurus]; igM-associated peptide; mAIM; Pdp; Pdp 1/6; PRO229; SCAVENGER RECEPTOR CYSTEINE-RICH FAMILY; Spalpha; Sp-alpha; UNQ203/PRO229
Common Name CD5L
Gene Symbol Cd5l
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGCGAASGTPSGILYEPPAEKEQKVLIQSVSCTGTEDTLAQCEQEEVYDC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.