Invitrogen™ Human AIF (aa 399-507) Control Fragment Recombinant Protein

Product Code. 30194003

Brand: Invitrogen™ RP91903

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Apoptosis Inducing Factor (AIF) causes chromatin condensation and DNA fragmentation. AIF was recently identified, and cloned. Apoptosis is characterized by several morphological nuclear changes including chromatin condensation and nuclear fragmentation. These changes are triggered by the activation of members of caspase family, caspase activated DNase, and several novel proteins. Like the critical molecules, cytochrome c and caspase-9, in apoptosis, AIF localizes in mitochondria. AIF translocates to the nucleus when apoptosis is induced and induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. AIF induces chromatin condensation and large scale DNA fragmentation, which are the hallmarks of apoptosis, of the isolated nucleus and the nucleus in live cells by microinjection and apoptosis stimuli. AIF is highly conserved between human and mouse and widely expressed. Mutations in the AIF gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. Alternative splicing results in multiple transcript variants of AIF and a related pseudogene has been identified on chromosome 10.

Specifications

• Accession Number: O95831
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9131
• Name: Human AIF (aa 399-507) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AG1; AGR1; Aif; AIFM1; AIFsh2; apoptosis inducing factor mitochondria associated 1; apoptosis inducing factor, mitochondria associated 1; apoptosis-inducing factor 1, mitochondrial; apoptosis-inducing factor, mitochondrion-associated 1; apoptosis-inducing factor, mitochondrion-associated, 1; CMT2D; CMTX4; COWCK; COXPD6; DFNX5; ER protein 18; ER protein 19; ERP18; ERP19; hAG-1; harlequin; Hq; hTLP19; MGC111425; mitochondrial apoptosis-inducing factor 1; NADMR; NAMSD; pcd8; PDCD8; PDIA16; programmed cell death 8 (apoptosis-inducing factor); programmed cell death protein 8; RP3-438D16.2; striatal apoptosis-inducing factor; testicular secretory protein Li 4; TLP19; UNQ713/PRO1376
• Common Name: AIF
• Gene Symbol: AIFM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining