Invitrogen™ Human AGR2 (aa 21-144) Control Fragment Recombinant Protein

Product Code. 30209015

Brand: Invitrogen™ RP88670

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AGR2 (anterior gradient protein 2) and AGR3 are members of the anterior gradient homolog family. They are secreted cytoplasmic proteins which are involved in metastasis induction and p53 tumour supressor inhibition. They may serve as molecular markers and potential therapeutic targets for hormone-responsive breast tumours. AGR2 is ubiquitously expressed with upregulated expression in prostate cancer, breast cancer, lung cancer, renal carcinomas and endometrial carcinomas. AGR2 expression is positively correlated with that of the estrogen receptor (ER) and is negatively correlated with that of the epidermal growth factor receptor (EGFR).

Spécification

• Accession Number: O95994
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10551
• Name: Human AGR2 (aa 21-144) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AG2; AG-2; AGR2; agr2 protein; Agr2h; AII; AII type II arginase; anterior gradient 2; anterior gradient 2 homolog; anterior gradient 2 homologue; anterior gradient 2, protein disulphide isomerase family member; anterior gradient homolog 2; anterior gradient protein 2 homolog; ARG2; arginase 2; arginase II; arginase type II; arginase, type II; arginase-2, mitochondrial; AU022422; epididymis secretory protein Li 116; Gob4; Gob-4; HAG-2; HEL-S-116; HPC8; kidney arginase; kidney-type arginase; L-arginine amidinohydrolase; L-arginine ureahydrolase; mAG-2; nonhepatic arginase; Non-hepatic arginase; PDIA17; protein disulfide isomerase family A, member 17; protein Gob-4; secreted cement gland homolog; secreted cement gland protein XAG-2 homolog; Type II arginase; UNQ515/PRO1030; XAG-2
• Common Name: AGR2
• Gene Symbol: Agr2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining