Invitrogen™ Human AGPAT5 (aa 213-345) Control Fragment Recombinant Protein

Product Code. 30202351

Brand: Invitrogen™ RP89849

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52721 (PA5-52721. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.

Specifications

• Accession Number: Q9NUQ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55326
• Name: Human AGPAT5 (aa 213-345) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110013A05Rik; 1-acylglycerol-3-phosphate O-acyltransferase 5; 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon); 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon; 1-AGP acyltransferase 5; 1-AGPAT 5; 1 AGPAT5; 1-AGPAT5; AGPAT5; D8Ertd319e; EC 2.3.1.51; LPAATE; LPAAT-epsilon; lysophosphatidic acid acyltransferase epsilon; RGD1306405; testicular tissue protein Li 144
• Common Name: AGPAT5
• Gene Symbol: AGPAT5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VAFDCMKNYLDAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVNSKLSIKKTLPSMLILSGLTAGMLMTDAGRKLY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining