missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human AGPAT2 (aa 211-273) Control Fragment Recombinant Protein

Product Code. 30202976
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202976

Brand: Invitrogen™ RP91098

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54020 (PA5-54020. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lysophospholipid acyltransferases (LPLATs) catalyse the addition of fatty acyl moieties to the glycerol backbone of lysophospholipids. In addition to playing a crutial role in the synthesis of structural membrane components the LPLATs are also implicated in cellular signalling responses for cytokines, growth factors and other agonists. Cellular signalling through the interleukin 1 receptor in human mesangial cells and EL-4 cells proceeds by the activation of lysophosphatidic acid acyltransferase (LPAAT). Activation of LPAAT by interleukin 1 results in the generation of unsaturated phosphatidic acid species, that are crucial to the generation of diacylglycerol and interleukin 1 signalling. LPLATs are also involved in signalling for increased interleukin 2 synthesis through the T cell antigen receptor. Activation of T-cells via anti-CD3 stimulation has been shown to increase incorporation of polyunsaturated fatty acids intophosphatidylcholine via lysophosphatidylcholine acyltransferase.Activation of this enzyme is essential for the sustained activationand translocation of protein kinase C.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15120
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10555
Name Human AGPAT2 (aa 211-273) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1-acylglycerol-3-phosphate O-acyltransferase 2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; 1-AGP acyltransferase 2; 1-AGPAT 2; 1-AGPAT2; 2510002J07Rik; AGPAT2; AV000834; BSCL; BSCL1; LPAAB; LPAAT-beta; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; testicular tissue protein Li 143
Common Name AGPAT2
Gene Symbol AGPAT2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.