Invitrogen™ Human AFP (aa 299-434) Control Fragment Recombinant Protein

Product Code. 30200537

Brand: Invitrogen™ RP102386

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AFP (Alpha Fetoprotein) is a major plasma protein produced by the yolk sac, intestinal tract and the liver during fetal life. AFP expression in adults is often associated with hepatoma or teratoma. However, hereditary persistence of AFP may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and AFP and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. AFP is found in monomeric, dimeric, and trimeric forms. AFP can also bind to copper ions, nickel ions, fatty acids and bilirubin. The level of AFP in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. High level of serum AFP has been identified in patients with hepatocellular carcinomas (HCC), teratoblastoma, colorectal cancer, pancreatic cancer, and germ cell neoplasms.

Specifications

• Accession Number: P02771
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 174
• Name: Human AFP (aa 299-434) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a fetoglobulin; a fetoprotein; Afp; AFPD; Alpha fetoglobulin; alpha fetoprotein; alpha-1-fetoprotein; Alpha-fetoglobulin; alpha-fetoprotein; alpha-fetoprotein precursor; alpha-foetoprotein; chloride intracellular channel 6; FETA; fetoglobulin; fetoprotein; HPAFP; a fetoglobulin; a fetoprotein
• Common Name: AFP
• Gene Symbol: AFP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQKLGEYYLQNAFLVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining