Invitrogen™ Human AFG3L2 (aa 503-649) Control Fragment Recombinant Protein

Product Code. 30208283

Brand: Invitrogen™ RP102421

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52081 (PA5-52081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AFG3L2 is a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. AFG3L2 gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders. This gene encodes a protein localized in mitochondria and closely related to paraplegin. The paraplegin gene is responsible for an autosomal recessive form of hereditary spastic paraplegia. This gene is a candidate gene for other hereditary spastic paraplegias or neurodegenerative disorders.

Specifications

• Accession Number: Q9Y4W6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10939
• Name: Human AFG3L2 (aa 503-649) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310036I02Rik; AFG3 ATPase family gene 3-like 2; AFG3 ATPase family member 3-like 2; AFG3 like AAA ATPase 2; AFG3 like matrix AAA peptidase subunit 2; AFG3(ATPase family gene 3)-like 2; AFG3L2; AFG3-like AAA ATPase 2; AFG3-like protein 2; AFG3-like protein 2 (Paraplegin-like protein); ATPase family gene 3, yeast; AW260507; Emv66; FLJ25993; par; paraplegin-like protein; SCA28; si:ch211-12e1.4; similar to AFG3-like protein 2 (Paraplegin-like protein); SPAX5
• Common Name: AFG3L2
• Gene Symbol: AFG3L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining