Invitrogen™ Human AFF2 (aa 715-855) Control Fragment Recombinant Protein

Product Code. 30195604

Brand: Invitrogen™ RP92219

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51834 (PA5-51834. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AFF2 belongs to the AF4 family. Defects in AFF2 are the cause of FRAXE. The exact function of AFF2 remains unknown.

Specifications

• Accession Number: P51816
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2334
• Name: Human AFF2 (aa 715-855) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AF4/FMR2 family member 2; AF4/FMR2 family member 2; LOW QUALITY PROTEIN: AF4/FMR2 family member 2; AF4/FMR2 family, member 2; AFF2; Fmr2; FMR2P; fragile x E mental retardation syndrome protein; fragile x mental retardation 2; fragile x mental retardation 2 homolog; fragile x mental retardation 2 protein; Fragile x mental retardation protein 2 homolog; FRAXE; MR x 2; O x 19; O x 19 homolog; Oxh; Protein FMR-2; Protein O x 19; RGD1565592; si:ch211-76h4.1
• Common Name: AFF2
• Gene Symbol: AFF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSTSDSNTDQEETLQIKVLPPCIISGGNTAKSKEICGASLTLSTLMSSSGSNNNLSISNEEPTFSPIPVMQTEILSPLRDHENLKNLWVKIDLDLLSRVPGHSSLHAAPAKPDHKETATKPKRQTAVTAVEKPAPKGKRKH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining