missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Afadin (aa 1463-1565) Control Fragment Recombinant Protein

Product Code. 30196146
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196146

Brand: Invitrogen™ RP94823

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83131 (PA5-83131. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

AFDN belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55196
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4301
Name Human Afadin (aa 1463-1565) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5033403D15Rik; Af6; Af-6; Afadin; Afadin adherens junction formation factor; afadin, adherens junction formation factor; afadin; afadin, adherens junction formation factor; AFDN; ALL1-fused gene from chromosome 6 protein; FLJ34371; Gm314; I-afadin; MLL-AF6; MLLT4; myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4; myeloid/lymphoid or mixed-lineage leukemia 4; myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4; protein Af-6; RP3-431P23.3; RP3-470B24.4; S-afadin
Common Name Afadin
Gene Symbol Afdn
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.