Invitrogen™ Human Adropin (aa 38-75) Control Fragment Recombinant Protein

Product Code. 30182412

Brand: Invitrogen™ RP99889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60031 (PA5-60031. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adropin is involved in the regulation of glucose homestasis and lipid metabolism. It is a secreted protein encoded by the Energy Homeostasis Associated gene (ENHO) found in the brain and liver. In the liver, the protein has been found to increase in response to high-fat foods and decrease after fasting. The protein seems to play a role in controlling the activity of other metabolic genes, specifically those involved in the production of lipids from carbohydrates.

Specifications

• Accession Number: Q6UWT2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 375704
• Name: Human Adropin (aa 38-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110065P19Rik; 2310040A07Rik; Adropin; adropin-like; C9orf165; energy homeostasis associated; energy homeostasis-associated protein; ENHO; GAAI470; LOC100912292; RGD1565232; UNQ470; UNQ470/PRO830
• Common Name: Adropin
• Gene Symbol: ENHO
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining