Invitrogen™ Human ADH5 (aa 263-320) Control Fragment Recombinant Protein

Product Code. 30209806

Brand: Invitrogen™ RP96756

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60761 (PA5-60761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.

Specifications

• Accession Number: P11766
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 128
• Name: Human ADH5 (aa 263-320) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ADH1C; Adh2; Adh-2; ADH3; ADH-3; ADH5; Adh-5; ADH-B2; ADHX; alcohol dehydrogenase (class III), chi polypeptide; alcohol dehydrogenase 1 C (class I), gamma polypeptide; alcohol dehydrogenase 2; Alcohol dehydrogenase 5; alcohol dehydrogenase 5 (class III), chi polypeptide; alcohol dehydrogenase B2; Alcohol dehydrogenase class chi chain; alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; class III alcohol dehydrogenase; class III alcohol dehydrogenase, chi subunit; epididymis secretory sperm binding protein Li 60 p; FALDH; FDH; formaldehyde dehydrogenase; glutathione-dependent formaldehyde dehydrogenase; GSH-FDH; GSNOR; HEL-S-60 p; S-(hydroxymethyl)glutathione dehydrogenase; S-nitrosoglutathione reductase
• Common Name: ADH5
• Gene Symbol: ADH5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DYSFECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATRPFQLVTGRTWKGTAFG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining