Invitrogen™ Human Adenylate Kinase 8 (aa 141-248) Control Fragment Recombinant Protein

Product Code. 30196496

Brand: Invitrogen™ RP93050

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54918 (PA5-54918. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Enables AMP binding activity and nucleobase-containing compound kinase activity. Involved in nucleoside diphosphate phosphorylation and nucleoside triphosphate biosynthetic process. Located in 9+2 motile cilium.

Specifications

• Accession Number: Q96MA6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158067
• Name: Human Adenylate Kinase 8 (aa 141-248) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1190002A17Rik; Adenylate kinase 8; Adenylate kinase isoenzyme 4, mitochondrial (ATP-AMP transphosphorylase); AK 8; AK8; ATP-AMP transphosphorylase 8; C9orf98; DDX31; HypB, AroK, ADK and rho factor domain containing protein RGD1303144; putative adenylate kinase-like protein C9orf98; putative adenylate kinase-like protein C9orf98 homolog; RGD1303144; RP11-143F18.1
• Common Name: Adenylate Kinase 8
• Gene Symbol: Ak8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining