missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196216

Invitrogen™ Human Adenylate Kinase 7 (aa 489-622) Control Fragment Recombinant Protein

Product Code. 30196216
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196216

Brand: Invitrogen™ RP89094

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51956 (PA5-51956. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The adenylate kinases (AK) are a family of structurally and functionally related enzymes that catalyze a similar reaction, MgNTP + AMP = MgNDP + ADP (N = A or G). The AK enzymes are important for maintenance of homeostasis of the adenine and guanine nucleotide pools. AK1 is a cytosolic enzyme for which ATP is the substrate. AK2 catalyzes the same reaction as AK1, but it is localized in the mitochondrial intermembrane space. AK3 is present in the mitochondrial matrix and prefers GTP over ATP as the substrate.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96M32
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 122481
Name Human Adenylate Kinase 7 (aa 489-622) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930502N02Rik; adenylate kinase 7; AK 7; AK7; ATP-AMP transphosphorylase 7; putative adenylate kinase 7
Common Name Adenylate Kinase 7
Gene Symbol AK7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGEPRNYGLTDEEKAEEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.