Invitrogen™ Human Adenylate Kinase 5 (aa 240-316) Control Fragment Recombinant Protein

Product Code. 30204667

Brand: Invitrogen™ RP92480

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63420 (PA5-63420. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.

Specifications

• Accession Number: Q9Y6K8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26289
• Name: Human Adenylate Kinase 5 (aa 240-316) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adenylate kinase 5; adenylate kinase 6; adenylate kinase isoenzyme 5; AK 5; AK5; AK6; ATP-AMP transphosphorylase 5; MGC33326; wu:fj63a06
• Common Name: Adenylate Kinase 5
• Gene Symbol: AK5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining