Invitrogen™ Human Adenylate Kinase 4 (aa 164-194) Control Fragment Recombinant Protein

Product Code. 30181360

Brand: Invitrogen™ RP99815

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61978 (PA5-61978. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.

Specifications

• Accession Number: P27144
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 205
• Name: Human Adenylate Kinase 4 (aa 164-194) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adenylate kinase 3 alpha-like 1; Adenylate kinase 3-like; adenylate kinase 3-like {ECO:0000255; adenylate kinase 3-like 1; adenylate kinase 3-like 2; adenylate kinase 4; adenylate kinase 4, mitochondrial; adenylate kinase 4, mitochondrial {ECO:0000255; Adenylate kinase isoenzyme 4; adenylate kinase isoenzyme 4, mitochondrial; adenylate kinase isoenzyme 4, mitochondrial; adenylate kinase 4, mitochondrial; AK 4; AK 4 {ECO:0000255; AK3; Ak-3; Ak3b; Ak3l1; AK3L2; AK4; Ak-4; ATP-AMP transphosphorylase; D4Ertd274e; GTP:AMP phosphotransferase AK4; GTP:AMP phosphotransferase AK4 {ECO:0000255; GTP:AMP phosphotransferase AK4, mitochondrial; HAMAP-Rule:MF_03170}; mitochondrial adenylate kinase-3; nucleoside-triphosphate-adenylate kinase; RP4-686B20.1
• Common Name: Adenylate Kinase 4
• Gene Symbol: AK4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PEAVAARLRQYKDVAKPVIELYKSRGVLHQF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining