Invitrogen™ Human Adenylate Kinase 2 (aa 35-138) Control Fragment Recombinant Protein

Product Code. 30201406

Brand: Invitrogen™ RP91714

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53813 (PA5-53813. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Specifications

• Accession Number: P54819
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 204
• Name: Human Adenylate Kinase 2 (aa 35-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: adenylate kinase 2; adenylate kinase 2, mitochondrial; adenylate kinase 2, mitochondrial {ECO:0000255; Adenylate kinase 2, mitochondrial, N-terminally processed; adenylate kinase isoenzyme 2, mitochondrial; adenylate monophosphate kinase; adenylate monophosphate kinase {ECO:0000255; ADK2; AK 2; AK 2 {ECO:0000255; Ak2; Ak-2; ATP:AMP phosphotransferase; ATP:AMP phosphotransferase {ECO:0000255; ATP-AMP transphosphorylase 2; ATP-AMP transphosphorylase 2 {ECO:0000255; D4Ertd220e; HAMAP-Rule:MF_03168}; si:ch211-197n10.1; testis secretory sperm-binding protein Li 220 n; wu:fb34f05; wu:fj80e03
• Common Name: Adenylate Kinase 2
• Gene Symbol: AK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining