Invitrogen™ Human ADCY2 (aa 426-487) Control Fragment Recombinant Protein

Product Code. 30196350

Brand: Invitrogen™ RP96856

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADCY2 is a member of the family of adenylate cyclases, which are membrane-associated enzymes that catalyze the formation of the secondary messenger cyclic adenosine monophosphate(cAMP). This enzyme is insensitive to Ca(2+)/calmodulin, and is stimulated by the G protein beta and gamma subunit complex.

Specifications

• Accession Number: Q08462
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 108
• Name: Human ADCY2 (aa 426-487) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3',5'-cyclic AMP synthetase; AC2; Adcy2; adenylate cyclase 2; adenylate cyclase 2 (brain); adenylate cyclase II; adenylate cyclase type 2; Adenylate cyclase type II; adenylyl cyclase 2; ATP pyrophosphate-lyase 2; HBAC2; KIAA1060; mKIAA1060; type II adenylate cyclase; type II adenylyl cyclase
• Common Name: ADCY2
• Gene Symbol: ADCY2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPRHTLDGAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining