Invitrogen™ Human ADCY10 (aa 1495-1581) Control Fragment Recombinant Protein

Product Code. 30212871

Brand: Invitrogen™ RP90979

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53290 (PA5-53290. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.The protein encoded by this gene belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Specifications

• Accession Number: Q96PN6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55811
• Name: Human ADCY10 (aa 1495-1581) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3',5'-cyclic AMP synthetase; 4930431D04Rik; 4931412F17; Adcy10; adenylate cyclase 10; adenylate cyclase 10 (soluble); adenylate cyclase 10, soluble; Adenylate cyclase homolog; Adenylate cyclase type 10; AH-related protein; ATP pyrophosphate-lyase; epididymis secretory sperm binding protein Li 7 A; germ cell soluble adenylyl cyclase; HCA2; HEL-S-7 A; hsAC; RP1-313L4.2; Sac; SACI; Sacy; soluble adenylyl cyclase; testicular soluble adenylyl cyclase; testicular soluble adenylyl cyclase (SAC)
• Common Name: ADCY10
• Gene Symbol: ADCY10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining