Invitrogen™ Human ADCK2 (aa 489-608) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30206782	100 μL	100µL

Product Code. 30206782 Supplier Invitrogen™ Supplier No. RP91432

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57503 (PA5-57503. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).

Specifications

• Accession Number: Q7Z695
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90956
• Name: Human ADCK2 (aa 489-608) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA408112; AARF; aarF domain containing kinase 2; Adck2; BB006057; MGC20727; putative ubiquinone biosynthesis protein AarF; uncharacterized aarF domain-containing protein kinase 2
• Common Name: ADCK2
• Gene Symbol: ADCK2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVEGFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGLGRSLDPKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining