Invitrogen™ Human ADAT1 (aa 99-190) Control Fragment Recombinant Protein

Product Code. 30182233

Brand: Invitrogen™ RP98539

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83523 (PA5-83523. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, proteins encoded by these genes participate in the pre-mRNA editing of nuclear transcripts. The protein encoded by this gene, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Specifications

• Accession Number: Q9BUB4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23536
• Name: Human ADAT1 (aa 99-190) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Adat1; Adenosine deaminase; adenosine deaminase acting on tRNA; adenosine deaminase tRNA specific 1; adenosine deaminase, tRNA specific 1; adenosine deaminase, tRNA-specific 1; HADAT1; mADAT1; MMADAT1; tRNA-specific 1; tRNA-specific adenosine deaminase 1; tRNA-specific adenosine-37 deaminase; zgc:162299
• Common Name: ADAT1
• Gene Symbol: ADAT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining