Invitrogen™ Human ADAMTS9 (aa 1579-1672) Control Fragment Recombinant Protein

Product Code. 30197574

Brand: Invitrogen™ RP104591

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS proteases are secreted enzymes containing a prometalloprotease domain of the reprolysin type. The ADAMTS proteases function in processing of procollagens and von Willebrand factor as well as catabolism of aggrecan, versican and brevican. They have been demonstrated to have important roles in connective tissue organization, coagulation, inflammation, arthritis, angiogenesis and cell migration. The immunizing peptide sequence is 100% conserved between human, mouse and rat. ADAMTS9 is a member of the ADAMs family of proteinases with Thrombospondin motifs. ADAMTS9 is closest in homology to ADAMTS20, sharing 54% overall identity, and like ADAMTS20 ADAMTS9 gas a GON-like domain at the carboxyterminal end. The GON domain at the carboxyterminal end is similar to the GON-1 protein in C. elegans, mutations of which lead to defective gonadal development. ADAMTS9 is expressed in ovary and testis, but little is known about the role of ADAMTS9 in reproductive organs. ADAMTS9 is also expressed in the heart, placenta, lung, skeletal tissue, and pancreas, so the protein must have wider functions than just gonadal development. ADAMTS9, like ADAMTS20, has a total of 15 thrombospondin-like domains.

Specifications

• Accession Number: Q9P2N4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56999
• Name: Human ADAMTS9 (aa 1579-1672) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 9; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 9; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 9; ADAM metallopeptidase with thrombospondin type 1 motif, 9; ADAMs; ADAM-TS 9; ADAMTS9; JSCFDG; KIAA1312; metalloendopeptidases
• Common Name: ADAMTS9
• Gene Symbol: ADAMTS9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KVVCVDDNKNEVHGARCDVSKRPVDRESCSLQPCEYVWITGEWSECSVTCGKGYKQRLVSCSEIYTGKENYEYSYQTTINCPGTQPPSVHPCYL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining