Invitrogen™ Human ADAMTS8 (aa 769-838) Control Fragment Recombinant Protein

Product Code. 30209213

Brand: Invitrogen™ RP104228

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64274 (PA5-64274. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene contains two C-terminal TS motifs, and disrupts angiogenesis in vivo. A number of disorders have been mapped in the vicinity of this gene, most notably lung neoplasms.

Specifications

• Accession Number: Q9UP79
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11095
• Name: Human ADAMTS8 (aa 769-838) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 8; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 8; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 8; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 8; ADAM metallopeptidase with thrombospondin type 1 motif, 8; ADAMs; ADAM-TS 8; ADAMTS8; ADAM-TS8; ADAMTS-8; ADAMTS-8 precursor (A disintegrin and metalloproteinase with thrombospondin motifs 8) (ADAM-TS 8) (ADAM-TS8) (METH-2); EC 3.4.24.14; EC 3.4.24.82; FLJ41712; metalloendopeptidases; METH2; METH-2; METH2ADAM-TS METH-8; METH-8
• Common Name: ADAMTS8
• Gene Symbol: ADAMTS8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SIATLERLQSFRPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining