Invitrogen™ Human ADAMTS4 (aa 104-195) Control Fragment Recombinant Protein

Product Code. 30203023

Brand: Invitrogen™ RP106333

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.

Specifications

• Accession Number: O75173
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9507
• Name: Human ADAMTS4 (aa 104-195) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3830423K05; a disintegrin and metallopeptidase with thrombospondin motifs 4; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 4; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 4; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 4; ADAM metallopeptidase with thrombospondin type 1 motif, 4; ADAMs; ADAM-TS 4; ADAMTS family member; ADAMTS-2; Adamts4; ADAM-TS4; ADAMTS-4; ADMP-1; Aggrecanase; Aggrecanase 1; aggrecanase-1; disintegrin and metalloproteinase with thrombospondin motifs 2; KIAA0688; metalloendopeptidases; metalloproteinase; mKIAA0688; UNQ769/PRO1563
• Common Name: ADAMTS4
• Gene Symbol: ADAMTS4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGTPNSAGGPGAHILRRKSPASGQGPMCN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining