Invitrogen™ Human ADAMTS19 (aa 664-751) Control Fragment Recombinant Protein

Product Code. 30201134

Brand: Invitrogen™ RP106856

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66170 (PA5-66170. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS16, another family member.

Specifications

• Accession Number: Q8TE59
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 171019
• Name: Human ADAMTS19 (aa 664-751) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4831407I23Rik; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 19; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 19; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 19; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 19; ADAM metallopeptidase with thrombospondin type 1 motif, 19; ADAMs; ADAM-TS 19; Adamts19; ADAM-TS19; ADAMTS-19; AU015154; D230034E10Rik; metalloendopeptidases
• Common Name: ADAMTS19
• Gene Symbol: ADAMTS19
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEEKPCALFCSPVGKEQPILLSEKVMDGTSCGYQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining