Invitrogen™ Human ADAMTS18 (aa 62-161) Control Fragment Recombinant Protein

Product Code. 30194153

Brand: Invitrogen™ RP92473

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60675 (PA5-60675. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by gene ADAMTS16, another family member. It is thought to function as a tumor suppressor. Alternatively spliced transcript variants have been identified, but their biological validity has not been determined.

Specifications

• Accession Number: Q8TE60
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 170692
• Name: Human ADAMTS18 (aa 62-161) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9630038L21; a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 18; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 18; ADAM metallopeptidase with thrombospondin type 1 motif, 18; ADAMs; ADAM-TS 18; ADAMTS18; ADAM-TS18; ADAMTS-18; ADAMTS21; disintegrin and metalloprotease-like protein; E130314N14Rik; KNO2; metalloendopeptidases; MMCAT; RGD1560118; sb:eu2468
• Common Name: ADAMTS18
• Gene Symbol: ADAMTS18
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSSHFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVST
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining