missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAMTS16 (aa 166-235) Control Fragment Recombinant Protein

Product Code. 30205302
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30205302 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30205302 Supplier Invitrogen™ Supplier No. RP109138

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144892 (PA5-144892, PA5-139886 (PA5-139886. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has high sequence similarity to the protein encoded by ADAMTS18, another family member.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TE57
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 170690
Name Human ADAMTS16 (aa 166-235) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 16; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 16; a disintegrin-like and metallopetidase (reprolysin type) with thrombospondin type 1 motif, 16; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 16; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 16 preproprotein; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 16; ADAM metallopeptidase with thrombospondin type 1 motif, 16; ADAMs; ADAM-TS 16; ADAMTS16; ADAM-TS16; ADAMTS-16; ADAMTS16s; KIAA2029; metalloendopeptidases
Common Name ADAMTS16
Gene Symbol ADAMTS16
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.