Invitrogen™ Human ADAMTS13 (aa 1285-1376) Control Fragment Recombinant Protein

Product Code. 30213418

Brand: Invitrogen™ RP108889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139814 (PA5-139814. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAMTS13 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme is the von Willebrand Factor (vWF)-cleaving protease, which is responsible for cleaving at the site of Tyr842-Met843 of the vWF molecule. A deficiency of this enzyme is associated with thrombotic thrombocytopenic purpura.

Specifications

• Accession Number: Q76LX8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11093
• Name: Human ADAMTS13 (aa 1285-1376) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metalloproteinase; A disintegrin and metalloproteinase with thrombospondin motifs 13; A disintegrin and metalloproteinase with thrombospondin motifs 13-like; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; ADAM; ADAM metallopeptidase with thrombospondin type 1 motif 13; ADAM metallopeptidase with thrombospondin type 1 motif, 13; ADAMs; ADAM-TS 13; ADAMTS13; ADAM-TS13; ADAMTS-13; C9orf8; Gm710; LOC102554393; metalloendopeptidases; UNQ6102/PRO20085; von Willebrand factor-cleaving protease; vWF-cleaving protease; VWFCP; vWF-CP; vWF-CP mRNA for von Willebrand factor-cleaving
• Common Name: ADAMTS13
• Gene Symbol: ADAMTS13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining