Invitrogen™ Human ADAM7 (aa 22-169) Control Fragment Recombinant Protein

Product Code. 30212606

Brand: Invitrogen™ RP89230

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52620 (PA5-52620. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.The ADAM family is composed of zinc-binding proteins that can function as adhesion proteins and/or endopeptidases. They are involved in a number of biologic processes, including fertilization, neurogenesis, muscle development, and immune response.[supplied by OMIM].

Specifications

• Accession Number: Q9H2U9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8756
• Name: Human ADAM7 (aa 22-169) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9230104J12Rik; a disintegrin and metallopeptidase domain 7; a disintegrin and metalloprotease domain (ADAM) 7; a disintegrin and metalloprotease domain 7; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 7; ADAM; ADAM 7; ADAM metallopeptidase domain 7; Adam7; ADAM-7; ADAMs; Disintegrin and metalloproteinase domain-containing protein 7; EAP1; EAPI; epididymal apical protein I; GP83; GP-83; metalloendopeptidases; Sperm maturation-related glycoprotein GP-83
• Common Name: ADAM7
• Gene Symbol: ADAM7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGVEGQQLVRPKKLPLIQKRDTGHTHDDDILKTYEEELLYEIKLNRKTLVLHLLRSREFLGSNYSETFYSMKGEAFTRHPQIMDHCFYQGSIVHEYDSAASISTCNGLRGFFRINDQRYLIEPVKYSDEGEHLVFKYNLRVPYGANYS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining