missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAM32 (aa 498-573) Control Fragment Recombinant Protein

Product Code. 30205788
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205788

Brand: Invitrogen™ RP107136

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84536 (PA5-84536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the disintegrin family of membrane-anchored proteins that play a role in diverse biological processes such as brain development, fertilization, tumor development and inflammation. This gene is predominantly expressed in the testis. The encoded protein undergoes proteolytic processing to generate a mature polypeptide comprised of an metalloprotease, disintegrin and epidermal growth factor-like domains. This gene is located in a cluster of other disintegrin and metallopeptidase family genes on chromosome 8. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TC27
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 203102
Name Human ADAM32 (aa 498-573) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metallopeptidase domain 32; a disintegrin and metalloprotease domain 32; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 32; ADAM; ADAM 32; ADAM metallopeptidase domain 32; Adam32; ADAMs; Disintegrin and metalloproteinase domain-containing protein 32; FLJ26299; FLJ29004; metalloendopeptidases; metalloprotease/disintegrin; metalloproteinase 12-like protein; testicular tissue protein Li 13; UNQ5982/PRO21340
Common Name ADAM32
Gene Symbol ADAM32
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.