Invitrogen™ Human ADAM32 (aa 498-573) Control Fragment Recombinant Protein

Product Code. 30205788

Brand: Invitrogen™ RP107136

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84536 (PA5-84536. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the disintegrin family of membrane-anchored proteins that play a role in diverse biological processes such as brain development, fertilization, tumor development and inflammation. This gene is predominantly expressed in the testis. The encoded protein undergoes proteolytic processing to generate a mature polypeptide comprised of an metalloprotease, disintegrin and epidermal growth factor-like domains. This gene is located in a cluster of other disintegrin and metallopeptidase family genes on chromosome 8. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Specifications

• Accession Number: Q8TC27
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 203102
• Name: Human ADAM32 (aa 498-573) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metallopeptidase domain 32; a disintegrin and metalloprotease domain 32; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 32; ADAM; ADAM 32; ADAM metallopeptidase domain 32; Adam32; ADAMs; Disintegrin and metalloproteinase domain-containing protein 32; FLJ26299; FLJ29004; metalloendopeptidases; metalloprotease/disintegrin; metalloproteinase 12-like protein; testicular tissue protein Li 13; UNQ5982/PRO21340
• Common Name: ADAM32
• Gene Symbol: ADAM32
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDARCESVFGKGSRNAPFACYEEIQSQSDRFGNCGRDRNNKYVFCGWRNLICGRLVCTYPTRKPFHQENGDVIYAF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining