missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAM28 (aa 21-107) Control Fragment Recombinant Protein

Product Code. 30210970
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210970

Brand: Invitrogen™ RP107966

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67323 (PA5-67323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. Alternative splicing results in two transcript variants. The shorter version encodes a secreted isoform, while the longer version encodes a transmembrane isoform.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UKQ2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10863
Name Human ADAM28 (aa 21-107) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metallopeptidase domain 28; a disintegrin and metalloprotease domain 28; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 28; ADAM; ADAM 28; ADAM metallopeptidase domain 28; ADAM23; Adam28; ADAMs; C130072N01Rik; D430033C21Rik; disintegrin 1; disintegrin and metalloproteinase domain-containing protein 28; Dtgn1; eMDC II; eMDCII; Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; MDCL; MDC-L; MDC-Lm; MDC-Ls; metalloendopeptidases; metalloproteinase-disintegrin domain containing protein TECADAM; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L; metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L; TECADAM; Thymic epithelial cell-ADAM
Common Name ADAM28
Gene Symbol ADAM28
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.