Invitrogen™ Human ADAM28 (aa 21-107) Control Fragment Recombinant Protein

Product Code. 30210970

Brand: Invitrogen™ RP107966

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67323 (PA5-67323. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. Alternative splicing results in two transcript variants. The shorter version encodes a secreted isoform, while the longer version encodes a transmembrane isoform.

Specifications

• Accession Number: Q9UKQ2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10863
• Name: Human ADAM28 (aa 21-107) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metallopeptidase domain 28; a disintegrin and metalloprotease domain 28; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 28; ADAM; ADAM 28; ADAM metallopeptidase domain 28; ADAM23; Adam28; ADAMs; C130072N01Rik; D430033C21Rik; disintegrin 1; disintegrin and metalloproteinase domain-containing protein 28; Dtgn1; eMDC II; eMDCII; Epididymal metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; epididymial metalloproteinase-like, disintegrin-like, and cysteine-rich protein II; MDCL; MDC-L; MDC-Lm; MDC-Ls; metalloendopeptidases; metalloproteinase-disintegrin domain containing protein TECADAM; Metalloproteinase-like, disintegrin-like, and cysteine-rich protein L; metalloproteinase-like, disintegrin-like, and cysteine-rich protein-L; TECADAM; Thymic epithelial cell-ADAM
• Common Name: ADAM28
• Gene Symbol: ADAM28
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELPGVKKYEVVYPIRLHPLHKREAKEPEQQEQFETELKYKMTINGKIAVLYLKKNKNLLAPGYTETYYNSTGKEITTSPQIMDDCYY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining