missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ADAM17 (aa 302-427) Control Fragment Recombinant Protein

Product Code. 30213260
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213260

Brand: Invitrogen™ RP104925

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAM17 (disintegrin and metalloproteinase domain-containing protein 17) cleaves the membrane bound precusor of TNF-alpha to its mature soluble form. ADAM 17 is responsbile for the proteolytical release of soluble JAM3 from endothelial cells surface and the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1, and the amyloid precursor protein. It acts as an activator of the Notch pathway by mediating cleavage of Notch and generating the membrane-associated intermediate fragment called Notch extracellular truncation (NEXT). Mutations in the gene can result in inflammatory skin and bowel disease, neonatal 1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P78536
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6868
Name Human ADAM17 (aa 302-427) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metallopeptidase domain 17; a disintegrin and metalloprotease domain 17; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 17; a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme); ADAM; ADAM 17; ADAM metallopeptidase domain 17; ADAM metallopeptidase domain 18; Adam17; ADAM18; ADAMs; CD156B; CD156b antigen; CSVP; Disintegrin and metalloproteinase domain-containing protein 17; metalloendopeptidases; NISBD; NISBD1; Snake venom-like protease; TACE; TNF-alpha convertase; TNF-alpha converting enzyme; TNF-alpha-converting enzyme; tumor necrosis factor, alpha, converting enzyme
Common Name ADAM17
Gene Symbol ADAM17
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.