Invitrogen™ Human ADAM17 (aa 105-237) Control Fragment Recombinant Protein

Product Code. 30204201

Brand: Invitrogen™ RP90360

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAM17 (disintegrin and metalloproteinase domain-containing protein 17) cleaves the membrane bound precusor of TNF-alpha to its mature soluble form. ADAM 17 is responsbile for the proteolytical release of soluble JAM3 from endothelial cells surface and the proteolytic release of several other cell-surface proteins, including p75 TNF-receptor, interleukin receptor type II, p55 TNF-receptor, transforming growth factor-alpha, L-selectin, growth hormone receptor, MUC1, and the amyloid precursor protein. It acts as an activator of the Notch pathway by mediating cleavage of Notch and generating the membrane-associated intermediate fragment called Notch extracellular truncation (NEXT). Mutations in the gene can result in inflammatory skin and bowel disease, neonatal 1.

Specifications

• Accession Number: P78536
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6868
• Name: Human ADAM17 (aa 105-237) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: a disintegrin and metallopeptidase domain 17; a disintegrin and metalloprotease domain 17; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 17; a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme); ADAM; ADAM 17; ADAM metallopeptidase domain 17; ADAM metallopeptidase domain 18; Adam17; ADAM18; ADAMs; CD156B; CD156b antigen; CSVP; Disintegrin and metalloproteinase domain-containing protein 17; metalloendopeptidases; NISBD; NISBD1; Snake venom-like protease; TACE; TNF-alpha convertase; TNF-alpha converting enzyme; TNF-alpha-converting enzyme; tumor necrosis factor, alpha, converting enzyme
• Common Name: ADAM17
• Gene Symbol: ADAM17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEYTVKWQDFFTGHVVGEPDSRVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRMLVYKSEDIKNVSRLQSPKVCGYLKVDNEELLPKGLVDREPPEELVHRVKRRADPDPMKNTCKLLVVADHRFYR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining