Invitrogen™ Human ACYP2 (aa 13-84) Control Fragment Recombinant Protein

Product Code. 30201830

Brand: Invitrogen™ RP96197

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57216 (PA5-57216. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Its physiological role is not yet clear.

Specifications

• Accession Number: P14621
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 98
• Name: Human ACYP2 (aa 13-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310004B09Rik; acylphosphatase 2; acylphosphatase 2, muscle type; acylphosphatase, muscle type isozyme; Acylphosphatase-2; acylphosphate phosphohydrolase 2; ACYM; ACYP; ACYP2; testicular tissue protein Li 11
• Common Name: ACYP2
• Gene Symbol: ACYP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EVFGRVQGVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKVGSPSSRIDRTNFSNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining