Invitrogen™ Human ACY3 (aa 117-180) Control Fragment Recombinant Protein

Product Code. 30198148

Brand: Invitrogen™ RP97319

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58700 (PA5-58700. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACY3 belongs to the aspA/astE family. Aspartoacylase subfamily. Catalytic activity: N-acyl-L-aspartate + H(2)O = a carboxylate + L-aspartate.

Specifications

• Accession Number: Q96HD9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91703
• Name: Human ACY3 (aa 117-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610006H10Rik; AA3; AAIII; Acy3; ACY-3; Acylase III; aminoacylase 3; Aminoacylase III; Aminoacylase-3; Aspa2; aspartoacylase (aminoacylase) 3; aspartoacylase (aminocyclase) 3; aspartoacylase 3; aspartoacylase-2; aspartoacylase-3; AW107362; EGK_05921; HCBP1; HCV core-binding protein 1; hepatitis C virus core-binding protein 1; LOW QUALITY PROTEIN: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming); N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming); RGD1305394
• Common Name: ACY3
• Gene Symbol: Acy3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NTTANMGTCLIAKSSHEVFAMHLCRHLQLQYPELSCQVFLYQRSGEESYNLDSVAKNGLGLELG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining