missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208740

Invitrogen™ Human ACVR2A (aa 105-138) Control Fragment Recombinant Protein

Product Code. 30208740
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208740

Brand: Invitrogen™ RP100531

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Activin A receptor kinase (ACVR2A) is a type II member of the TGF-beta family of receptor Serine/Threonine kinases. ACVR2A is involved in the activin and myostatin signaling pathway. (ACVR2A Aliases: ACVR2, ACTRII). These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P27037
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92
Name Human ACVR2A (aa 105-138) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias activin A receptor type 2 A; activin A receptor type IIA; activin A receptor, type IIA; activin receptor IIA; activin receptor type IIA; Activin receptor type-2 A; Actrii; ActrIIa; ACTR-IIA; ACVR2; Acvr2a; rActR-II; TactrII; type II activin receptor
Common Name ACVR2A
Gene Symbol ACVR2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.