missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210278

Invitrogen™ Human ACVR1C (aa 311-405) Control Fragment Recombinant Protein

Product Code. 30210278
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210278

Brand: Invitrogen™ RP89781

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACVR1C, a serine/threonine protein kinase, is a type I receptor for the TGFB family of signaling molecules. The receptor complex consisting of 2 type II and 2 type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators, SMAD2 and SMAD3, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors. ACVR1C is a receptor for activin AB, activin B and NODAL. This protein plays a role in cell differentiation, growth arrest and apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NER5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 130399
Name Human ACVR1C (aa 311-405) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias activin A receptor type 1 C; activin A receptor type IC; activin A receptor, type IC; activin receptor type IC; Activin receptor type-1 C; activin receptor-like kinase 7; ACTRI; ACTR-IC; ACVR1A; acvr1c; acvr1c {ECO:0000312; ACVRLK2; ACVRLK7; ALK2; Alk7; ALK-7; C230097P10; EMBL:AAC52803.1}; FOP; habrec1; SKR1; TGF-beta type 1 receptor; TSRI
Common Name ACVR1C
Gene Symbol ACVR1C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQNPKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.