missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ACVR1B (aa 28-75) Control Fragment Recombinant Protein

Product Code. 30210954
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210954

Brand: Invitrogen™ RP103526

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111573 (PA5-111573. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACVR1B is a serine/threonine kinase involved in signal transduction and cellular communication. Several truncated ACVR1B isoforms have been reported to be exclusively expressed in human pituitary tumors. Mutations of ACVR1B have been observed in pancreatic adenocarcinomas. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1B encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P36896
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91
Name Human ACVR1B (aa 28-75) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6820432J04; activin A receptor type 1 B; activin A receptor type IB; activin A receptor, type 1 B; activin A receptor, type IB; activin A receptor, type II-like kinase 4; activin receptor type IB; Activin receptor type-1 B; activin receptor-like kinase 4; ACTRI; ActRIB; ActR-IB; ACVR1A; Acvr1b; ACVRLK2; ACVRLK4; ALK2; Alk4; ALK-4; FOP; Serine/threonine-protein kinase receptor R2; SKR1; SKR2; TSRI
Common Name ACVR1B
Gene Symbol ACVR1B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.