Invitrogen™ Human ACVR1B (aa 28-75) Control Fragment Recombinant Protein

Product Code. 30210954

Brand: Invitrogen™ RP103526

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111573 (PA5-111573. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ACVR1B is a serine/threonine kinase involved in signal transduction and cellular communication. Several truncated ACVR1B isoforms have been reported to be exclusively expressed in human pituitary tumors. Mutations of ACVR1B have been observed in pancreatic adenocarcinomas. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1B encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.

Specifications

• Accession Number: P36896
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91
• Name: Human ACVR1B (aa 28-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6820432J04; activin A receptor type 1 B; activin A receptor type IB; activin A receptor, type 1 B; activin A receptor, type IB; activin A receptor, type II-like kinase 4; activin receptor type IB; Activin receptor type-1 B; activin receptor-like kinase 4; ACTRI; ActRIB; ActR-IB; ACVR1A; Acvr1b; ACVRLK2; ACVRLK4; ALK2; Alk4; ALK-4; FOP; Serine/threonine-protein kinase receptor R2; SKR1; SKR2; TSRI
• Common Name: ACVR1B
• Gene Symbol: ACVR1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining