Invitrogen™ Human ACSS1 (aa 195-292) Control Fragment Recombinant Protein

Product Code. 30182803

Brand: Invitrogen™ RP99451

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59392 (PA5-59392. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a mitochondrial acetyl-CoA synthetase enzyme. A similar protein in mice plays an important role in the tricarboxylic acid cycle by catalyzing the conversion of acetate to acetyl CoA. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q9NUB1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84532
• Name: Human ACSS1 (aa 195-292) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110032O15Rik; Acas2; ACAS2L; ACECS1; AceCS2; AceCS2L; acetate--CoA ligase 2; Acetyl-CoA synthetase 2; acetyl-coenzyme A synthetase 2-like, mitochondrial; ACSS1; Acyl-CoA synthetase short-chain family member 1; AI788978; KIAA1846; Propionate--CoA ligase
• Common Name: ACSS1
• Gene Symbol: ACSS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTVQHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFML
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining