Invitrogen™ Human ACSBG1 (aa 205-280) Control Fragment Recombinant Protein

Product Code. 30181157

Brand: Invitrogen™ RP98019

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59659 (PA5-59659. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene possesses long-chain acyl-CoA synthetase activity. It is thought to play a central role in brain very long-chain fatty acids metabolism and myelinogenesis.

Specifications

• Accession Number: Q96GR2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23205
• Name: Human ACSBG1 (aa 205-280) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACSBG1; Acyl-CoA synthetase bubblegum family member 1; BG; BG1; BG1 protein; BGM; bubblegum; E230019G03Rik; Gonadotropin-regulated long chain acyl CoA synthetase; gonadotropin-regulated long chain acyl-CoA synthetase; Grlacs; GR-LACS; hBG1; KIAA0631; Lipidosin; lipidosis-related protein lipidosin; lipodisin; long-chain-fatty-acid--CoA ligase ACSBG1; LPD; mBG1; mKIAA0631; R75185; very long-chain acyl-CoA synthetase
• Common Name: ACSBG1
• Gene Symbol: ACSBG1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining