Invitrogen™ Human ACRBP (aa 118-214) Control Fragment Recombinant Protein

Product Code. 30180930

Brand: Invitrogen™ RP97713

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58650 (PA5-58650. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon. [provided by RefSeq, Jul 2008].

Specifications

• Accession Number: Q8NEB7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84519
• Name: Human ACRBP (aa 118-214) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ACRBP; acrbp {ECO:0000312; acrosin binding protein; acrosin-binding protein; Cancer/testis antigen 23; cancer/testis antigen OY-TES-1; CT23; EMBL:AAH79212.1}; OY-TES-1; proacrosin binding protein; proacrosin binding protein sp32; proacrosin-binding protein sp32; SP32; testicular tissue protein Li 10
• Common Name: ACRBP
• Gene Symbol: ACRBP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining